Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBacterial penicillin-binding protein
LigandBDBM50053179
Substrate/Competitorn/a
Meas. Tech.ChEMBL_153527
IC50>10000000±n/a nM
Citation Richter, HGAngehrn, PHubschwerlen, CKania, MPage, MGSpecklin, JLWinkler, FK Design, synthesis, and evaluation of 2 beta-alkenyl penam sulfone acids as inhibitors of beta-lactamases. J Med Chem39:3712-22 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bacterial penicillin-binding protein
Name:Bacterial penicillin-binding protein
Synonyms:DD-transpeptidase | Murein polymerase | PBP-1b | PBP1b | Penicillin-binding protein 1B | Penicillin-insensitive transglycosylase | Penicillin-sensitive transpeptidase | Peptidoglycan TGase | Peptidoglycan glycosyltransferase
Type:PROTEIN
Mol. Mass.:94304.04
Organism:Escherichia coli (strain K12)
Description:ChEMBL_153527
Residue:844
Sequence:
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RILPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDM
FGSN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053179
NameBDBM50053179
Synonyms:CHEMBL121924 | Sodium; (2S,3S,5R)-3-methyl-4,4,7-trioxo-3-((Z)-2-pyridin-2-yl-vinyl)-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylate
TypeSmall organic molecule
Emp. Form.C14H13N2O5S
Mol. Mass.321.329
SMILESC[C@]1(\C=C/c2ccccn2)[C@@H](N2[C@@H](CC2=O)S1(=O)=O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a