Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50241491
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34657
Ki 0.900000±n/a nM
Citation Wexler, RRGreenlee, WJIrvin, JDGoldberg, MRPrendergast, KSmith, RDTimmermans, PB Nonpeptide angiotensin II receptor antagonists: the next generation in antihypertensive therapy. J Med Chem39:625-56 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:ANGIOTENSIN AT1 | Angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41009.15
Organism:RABBIT
Description:ANGIOTENSIN AT1 AGTR1 RABBIT::P34976
Residue:359
Sequence:
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50241491
NameBDBM50241491
Synonyms:2-{4-Butyl-2-methyl-6-oxo-5-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-6H-pyrimidin-1-ylmethyl}-thiophene-3-carboxylic acid methyl ester | CHEMBL429847
TypeSmall organic molecule
Emp. Form.C30H30N6O3S
Mol. Mass.554.663
SMILESCCCCc1nc(C)n(Cc2sccc2C(=O)OC)c(=O)c1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a