Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50060082
Substrate/Competitorn/a
Meas. Tech.ChEMBL_146474
Kd 0.251000±n/a nM
Citation Salvadori, SBalboni, GGuerrini, RTomatis, RBianchi, CBryant, SDCooper, PSLazarus, LH Evolution of the Dmt-Tic pharmacophore: N-terminal methylated derivatives with extraordinary delta opioid antagonist activity. J Med Chem40:3100-8 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptor
Synonyms:DOR-1 | Delta-type opioid receptor | K56 | MSL-2 | OPIATE Delta | OPRD1
Type:Enzyme Catalytic Domain
Mol. Mass.:40577.25
Organism:MOUSE
Description:OPIATE Delta OPRD1 MOUSE::P32300
Residue:372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060082
NameBDBM50060082
Synonyms:2-({2-[(S)-3-(4-Hydroxy-2,6-dimethyl-phenyl)-2-methylamino-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carbonyl}-amino)-propionic acid | CHEMBL2370386
TypeSmall organic molecule
Emp. Form.C26H33N3O5
Mol. Mass.467.5573
SMILESC[C@H](NC(=O)[C@@H]1Cc2ccccc2CN1C(=O)[C@H](Cc1c(C)cc(O)cc1C)N(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a