Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmu/kappa opioid receptor
LigandBDBM50060083
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147101
IC50>10000±n/a nM
Citation Salvadori, SBalboni, GGuerrini, RTomatis, RBianchi, CBryant, SDCooper, PSLazarus, LH Evolution of the Dmt-Tic pharmacophore: N-terminal methylated derivatives with extraordinary delta opioid antagonist activity. J Med Chem40:3100-8 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mu/kappa opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:OPIATE Mu OPRM1 GUINEA PIG::P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060083
NameBDBM50060083
Synonyms:2-({2-[(S)-2-Dimethylamino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carbonyl}-amino)-propionic acid | CHEMBL3038229
TypeSmall organic molecule
Emp. Form.C24H29N3O5
Mol. Mass.439.5042
SMILESC[C@H](NC(=O)[C@@H]1Cc2ccccc2CN1C(=O)[C@H](N)Cc1c(C)cc(O)cc1C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a