Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM25400
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29131
Ki 0.30±n/a nM
Citation Franchetti, PCappellacci, LMarchetti, STrincavelli, LMartini, CMazzoni, MRLucacchini, AGrifantini, M 2'-C-Methyl analogues of selective adenosine receptor agonists: synthesis and binding studies. J Med Chem41:1708-15 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low
Type:Enzyme Catalytic Domain
Mol. Mass.:36602.99
Organism:BOVINE
Description:ADENOSINE 0 BOVINE::P28190
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDAPAERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25400
NameBDBM25400
Synonyms:(2R,3R,4S,5R)-2-[6-(cyclopentylamino)-9H-purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol | CHEMBL68738 | CPA | N6-CyclopentylAdo | N6-cyclopentyladenosine (CPA) | cid_657378
TypeSmall organic molecule
Emp. Form.C15H21N5O4
Mol. Mass.335.3583
SMILESOC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NC3CCCC3)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a