Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBDKRB2
LigandBDBM50067261
Substrate/Competitorn/a
Meas. Tech.ChEMBL_40264
IC50 3.8±n/a nM
Citation Abe, YKayakiri, HSatoh, SInoue, TSawada, YInamura, NAsano, MHatori, CSawai, HOku, TTanaka, H A novel class of orally active non-peptide bradykinin B2 receptor antagonists. 2. Overcoming the species difference between guinea pig and man. J Med Chem41:4053-61 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BDKRB2
Name:Bradykinin B2 receptor
Synonyms:B2 BRADYKININ | B2 bradykinin receptor | B2R | BK-2 receptor | Bradykinin B2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:44467.17
Organism:Homo sapiens (Human)
Description:B2 BRADYKININ BDKRB2 HUMAN::P30411
Residue:391
Sequence:
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50067261
NameBDBM50067261
Synonyms:CHEMBL556816 | N-[3-(3-Bromo-2-methyl-imidazo[1,2-a]pyridin-8-yloxymethyl)-2,4-dichloro-phenyl]-2-[3-(3-chloro-phenyl)-ureido]-N-methyl-acetamide; hydrochloride
TypeSmall organic molecule
Emp. Form.C25H21BrCl3N5O3
Mol. Mass.625.729
SMILESCN(C(=O)CNC(=O)Nc1cccc(Cl)c1)c1ccc(Cl)c(COc2cccn3c(Br)c(C)nc23)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a