Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM60917
Substrate/Competitorn/a
Meas. Tech.ChEMBL_60374
Ki 810±n/a nM
Citation Wilcox, RETseng, TBrusniak, MYGinsburg, BPearlman, RSTeeter, MDuRand, CStarr, SNeve, KA CoMFA-based prediction of agonist affinities at recombinant D1 vs D2 dopamine receptors. J Med Chem41:4385-99 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60917
NameBDBM60917
Synonyms:9-chloranyl-5-(4-hydroxyphenyl)-2,3,4,5-tetrahydro-1H-3-benzazepine-7,8-diol;methanesulfonic acid | 9-chloro-5-(4-hydroxyphenyl)-2,3,4,5-tetrahydro-1H-3-benzazepine-7,8-diol;mesylic acid | 9-chloro-5-(4-hydroxyphenyl)-2,3,4,5-tetrahydro-1H-3-benzazepine-7,8-diol;methanesulfonic acid | FENOLDOPAM | FENOLDOPAM MESYLATE | MLS001401388 | SMR000469190 | cid_49659
TypeSmall organic molecule
Emp. Form.C16H16ClNO3
Mol. Mass.305.756
SMILESOc1ccc(cc1)C1CNCCc2c(Cl)c(O)c(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a