Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50064109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144609
IC50 5±n/a nM
Citation Wallace, EMMoliterni, JAMoskal, MANeubert, ADMarcopulos, NStamford, LBTrapani, AJSavage, PChou, MJeng, AY Design and synthesis of potent, selective inhibitors of endothelin-converting enzyme. J Med Chem41:1513-23 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CALLA | CD_antigen=CD10 | Common acute lymphocytic leukemia antigen | Enkephalinase | NEP | Neutral Endopeptidase (NEP) | Neutral endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85505.38
Organism:Homo sapiens (Human)
Description:P08473
Residue:750
Sequence:
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064109
NameBDBM50064109
Synonyms:CGS-31447 | CHEMBL285619 | {1-[(S)-2-Biphenyl-4-yl-1-(2H-tetrazol-5-yl)-ethylamino]-3-naphthalen-1-yl-propyl}-phosphonic acid | {1-[2-Biphenyl-4-yl-1-(1H-tetrazol-5-yl)-ethylamino]-3-naphthalen-1-yl-propyl}-phosphonic acid | {1-[2-Biphenyl-4-yl-1-(1H-tetrazol-5-yl)-ethylamino]-3-naphthalen-1-yl-propyl}-phosphonic acid(CGS-31,447)
TypeSmall organic molecule
Emp. Form.C28H28N5O3P
Mol. Mass.513.5274
SMILESOP(O)(=O)C(CCc1cccc2ccccc12)N[C@@H](Cc1ccc(cc1)-c1ccccc1)c1nnn[nH]1
Structure
n/a