Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50073492
Substrate/Competitorn/a
Meas. Tech.ChEMBL_139631
IC50 244±n/a nM
Citation Augelli-Szafran, CEBlankley, CJJaen, JCMoreland, DWNelson, CBPenvose-Yi, JRSchwarz, RDThomas, AJ Identification and characterization of m1 selective muscarinic receptor antagonists1. J Med Chem42:356-63 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073492
NameBDBM50073492
Synonyms:1-Ethyl-4-phenyl-1,2,5,6-tetrahydro-pyridine-3-carboxylic acid phenethyl ester; oxalic acid | CHEMBL262198
TypeSmall organic molecule
Emp. Form.C22H25NO2
Mol. Mass.335.4394
SMILESCCN1CCC(=C(C1)C(=O)OCCc1ccccc1)c1ccccc1 |c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a