Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50073623
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88621
IC50 1030±n/a nM
Citation King, PJMa, GMiao, WJia, QMcDougall, BRReinecke, MGCornell, CKuan, JKim, TRRobinson, WE Structure-activity relationships: analogues of the dicaffeoylquinic and dicaffeoyltartaric acids as potent inhibitors of human immunodeficiency virus type 1 integrase and replication. J Med Chem42:497-509 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073623
NameBDBM50073623
Synonyms:(E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 4-[(E)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester | CHEMBL149826
TypeSmall organic molecule
Emp. Form.C24H24O8
Mol. Mass.440.4426
SMILESOc1ccc(\C=C\C(=O)OC2CCC(CC2)OC(=O)\C=C\c2ccc(O)c(O)c2)cc1O |(-2.66,-3.51,;-1.31,-4.26,;.02,-3.48,;1.36,-4.24,;1.36,-5.78,;2.7,-6.55,;4.03,-5.78,;5.38,-6.53,;5.39,-8.07,;6.71,-5.76,;8.26,-5.71,;9.06,-7.01,;10.6,-6.97,;11.34,-5.62,;10.53,-4.31,;8.99,-4.35,;12.88,-5.57,;14.22,-4.8,;14.22,-3.26,;15.56,-5.57,;16.89,-4.8,;18.22,-5.57,;18.22,-7.12,;19.56,-7.89,;20.9,-7.12,;22.24,-7.89,;20.89,-5.56,;22.22,-4.79,;19.56,-4.8,;.05,-6.57,;-1.3,-5.81,;-2.63,-6.6,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a