Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50088353
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88615
IC50 1400±n/a nM
Citation Carlson, HAMasukawa, KMRubins, KBushman, FDJorgensen, WLLins, RDBriggs, JMMcCammon, JA Developing a dynamic pharmacophore model for HIV-1 integrase. J Med Chem43:2100-14 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088353
NameBDBM50088353
Synonyms:5-(3,4-Dihydroxy-phenyl)-3-hydroxy-pentanoic acid 2-(3,4-dihydroxy-phenyl)-6,7-dihydroxy-chroman-3-yl ester | CHEMBL304722 | NSC-607319
TypeSmall organic molecule
Emp. Form.C26H26O10
Mol. Mass.498.4786
SMILESOC(CCc1ccc(O)c(O)c1)CC(=O)O[C@H]1Cc2cc(O)c(O)cc2O[C@H]1c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a