Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptide deformylase
LigandBDBM50089197
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154575
IC50 100±n/a nM
Citation Apfel, CBanner, DWBur, DDietz, MHirata, THubschwerlen, CLocher, HPage, MGPirson, WRossé, GSpecklin, JL Hydroxamic acid derivatives as potent peptide deformylase inhibitors and antibacterial agents. J Med Chem43:2324-31 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptide deformylase
Name:Peptide deformylase
Synonyms:3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2
Type:n/a
Mol. Mass.:16901.39
Organism:Escherichia coli
Description:n/a
Residue:150
Sequence:
MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50089197
NameBDBM50089197
Synonyms:3-Benzenesulfinyl-heptanoic acid hydroxyamide | CHEMBL75433
TypeSmall organic molecule
Emp. Form.C13H19NO3S
Mol. Mass.269.36
SMILESCCCCC(CC(=O)NO)S(=O)c1ccccc1
Structure
n/a