Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4 (mGluR4)
LigandBDBM50089890
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106560
Ki 21000±n/a nM
Citation Bräuner-Osborne, HEgebjerg, JNielsen, EOMadsen, UKrogsgaard-Larsen, P Ligands for glutamate receptors: design and therapeutic prospects. J Med Chem43:2609-45 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 4 (mGluR4)
Name:Metabotropic glutamate receptor 4
Synonyms:GRM4 | Glutamate receptor, metabotropic 4 | Metabotropic glutamate receptor 4 | mGluR4 | metabotropic glutamate 4
Type:Protein
Mol. Mass.:101899.95
Organism:Homo sapiens (Human)
Description:Q14833
Residue:912
Sequence:
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50089890
NameBDBM50089890
Synonyms:4-Amino-2-oxa-bicyclo[3.1.0]hexane-4,6-dicarboxylic acid(LY379268) | CHEMBL89000
TypeSmall organic molecule
Emp. Form.C7H9NO5
Mol. Mass.187.1501
SMILESN[C@]1(COC2[C@@H](C12)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a