Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric Oxide Synthase, inducible
LigandBDBM50090931
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89364
Ki 1900000±n/a nM
Citation Huang, HMartásek, PRoman, LJSilverman, RB Synthesis and evaluation of peptidomimetics as selective inhibitors and active site probes of nitric oxide synthases. J Med Chem43:2938-45 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric Oxide Synthase, inducible
Name:Nitric oxide synthase, inducible
Synonyms:Inducible NO synthase | Inducible NOS | Inducible nitric oxide synthase (iNOS) | MAC-NOS | Macrophage NOS | NOS type II | Nitric oxide synthase, inducible (iNOS)
Type:Enzyme
Mol. Mass.:130595.79
Organism:Mus musculus (mouse)
Description:Recombinant enzyme overexpressed in E. coli.
Residue:1144
Sequence:
MACPWKFLFKVKSYQSDLKEEKDINNNVKKTPCAVLSPTIQDDPKSHQNGSPQLLTGTAQ
NVPESLDKLHVTSTRPQYVRIKNWGSGEILHDTLHHKATSDFTCKSKSCLGSIMNPKSLT
RGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDEL
IFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITV
FPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLP
LVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEFPA
CPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVAVLHSF
QKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNYVLS
PFYYYQIEPWKTHIWQNEKLRPRRREIRFRVLVKVVFFASMLMRKVMASRVRATVLFATE
TGKSEALARDLATLFSYAFNTKVVCMDQYKASTLEEEQLLLVVTSTFGNGDCPSNGQTLK
KSLFMLRELNHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQE
DAFRSWAVQTFRAACETFDVRSKHHIQIPKRFTSNATWEPQQYRLIQSPEPLDLNRALSS
IHAKNVFTMRLKSQQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTALVQG
ILERVVDCPTPHQTVCLEVLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQLQLHKL
ARFATDETDRQRLEALCQPSEYNDWKFSNNPTFLEVLEEFPSLHVPAAFLLSQLPILKPR
YYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWIRNLKPQDPVPCFVRSVSG
FQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGRMSLVFGCRHPEEDHLYQ
EEMQEMVRKRVLFQVHTGYSRLPGKPKVYVQDILQKQLANEVLSVLHGEQGHLYICGDVR
MARDVATTLKKLVATKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGSALEEPK
ATRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50090931
NameBDBM50090931
Synonyms:CHEMBL100761 | L-Arg NO2-(N-CH3)-L-Lys-NH2
TypeSmall organic molecule
Emp. Form.C13H28N8O4
Mol. Mass.360.4126
SMILESCN([C@@H](CCCCN)C(N)=O)C(=O)[C@@H](N)CCCNC(=N)N[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a