Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50092151
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196355
IC50 45±n/a nM
Citation Tyndall, JDReid, RCTyssen, DPJardine, DKTodd, BPassmore, MMarch, DRPattenden, LKBergman, DAAlewood, DHu, SHAlewood, PFBirch, CJMartin, JLFairlie, DP Synthesis, stability, antiviral activity, and protease-bound structures of substrate-mimicking constrained macrocyclic inhibitors of HIV-1 protease. J Med Chem43:3495-504 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:P04585[489-587]
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092151
NameBDBM50092151
Synonyms:(10S,13S,1'R)-13-[1'-HYDROXY-2'-(N-P-AMINOBENZENESULFONYL-1''-AMINO-3''-METHYLBUTYL)ETHYL]-8,11-DIOXO-10-ISOPROPYL-2-OXA-9,12-DIAZABICYCLO [13.2.2]NONADECA-15,17,18-TRIENE | 4-Amino-N-[(S)-2-(R)-hydroxy-2-((S)-10-isopropyl-8,11-dioxo-2-oxa-9,12-diaza-bicyclo[13.2.2]nonadeca-1(18),15(19),16-trien-13-yl)-ethyl]-N-(3-methyl-butyl)-benzenesulfonamide | 4-Amino-N-[2-hydroxy-2-(10-isopropyl-8,11-dioxo-2-oxa-9,12-diaza-bicyclo[13.2.2]nonadeca-1(18),15(19),16-trien-13-yl)-ethyl]-N-(3-methyl-butyl)-benzenesulfonamide | CHEMBL442738
TypeSmall organic molecule
Emp. Form.C32H48N4O6S
Mol. Mass.616.812
SMILESCC(C)CCN(C[C@@H](O)[C@@H]1Cc2ccc(OCCCCCC(=O)N[C@@H](C(C)C)C(=O)N1)cc2)S(=O)(=O)c1ccc(N)cc1
Structure
n/a