Reaction Details |
 | Report a problem with these data |
Target | Human immunodeficiency virus type 1 protease |
---|
Ligand | BDBM50092151 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_196352 |
---|
IC50 | 500±n/a nM |
---|
Citation | Tyndall, JD; Reid, RC; Tyssen, DP; Jardine, DK; Todd, B; Passmore, M; March, DR; Pattenden, LK; Bergman, DA; Alewood, D; Hu, SH; Alewood, PF; Birch, CJ; Martin, JL; Fairlie, DP Synthesis, stability, antiviral activity, and protease-bound structures of substrate-mimicking constrained macrocyclic inhibitors of HIV-1 protease. J Med Chem43:3495-504 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Human immunodeficiency virus type 1 protease |
---|
Name: | Human immunodeficiency virus type 1 protease |
Synonyms: | Pol polyprotein |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50092151 |
---|
Name | BDBM50092151 |
Synonyms: | (10S,13S,1'R)-13-[1'-HYDROXY-2'-(N-P-AMINOBENZENESULFONYL-1''-AMINO-3''-METHYLBUTYL)ETHYL]-8,11-DIOXO-10-ISOPROPYL-2-OXA-9,12-DIAZABICYCLO [13.2.2]NONADECA-15,17,18-TRIENE | 4-Amino-N-[(S)-2-(R)-hydroxy-2-((S)-10-isopropyl-8,11-dioxo-2-oxa-9,12-diaza-bicyclo[13.2.2]nonadeca-1(18),15(19),16-trien-13-yl)-ethyl]-N-(3-methyl-butyl)-benzenesulfonamide | 4-Amino-N-[2-hydroxy-2-(10-isopropyl-8,11-dioxo-2-oxa-9,12-diaza-bicyclo[13.2.2]nonadeca-1(18),15(19),16-trien-13-yl)-ethyl]-N-(3-methyl-butyl)-benzenesulfonamide | CHEMBL442738 |
Type | Small organic molecule |
Emp. Form. | C32H48N4O6S |
Mol. Mass. | 616.812 |
SMILES | CC(C)CCN(C[C@@H](O)[C@@H]1Cc2ccc(OCCCCCC(=O)N[C@@H](C(C)C)C(=O)N1)cc2)S(=O)(=O)c1ccc(N)cc1 |
Structure |  |
n/a |
---|