Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50087095
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28885
Ki 1.9±n/a nM
Citation Chen, HNoble, FMothé, AMeudal, HCoric, PDanascimento, SRoques, BPGeorge, PFournié-Zaluski, MC Phosphinic derivatives as new dual enkephalin-degrading enzyme inhibitors: synthesis, biological properties, and antinociceptive activities. J Med Chem43:1398-408 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase N
Synonyms:ANPEP | AP-M | AP-N | Alanyl aminopeptidase | Aminopeptidase M | Aminopeptidase N (APN) | CD_antigen=CD13 | Microsomal aminopeptidase | gp130 | pAPN
Type:Protein
Mol. Mass.:108810.25
Organism:Sus scrofa (Pig)
Description:P15145
Residue:963
Sequence:
MAKGFYISKALGILGILLGVAAVATIIALSVVYAQEKNKNAEHVPQAPTSPTITTTAAIT
LDQSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRLLCQEPTDVIIIHS
KKLNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGE
LADDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTA
LSNMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWAR
PNAIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYREN
ALLFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHA
EPTWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIR
MLSNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWT
LQMGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRD
VSQAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIY
DSFNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLR
KQVEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDP
ENNPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNR
YLGYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQ
GVTRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFI
EHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087095
n/a
NameBDBM50087095
Synonyms:1-{[3-(4-Bromo-phenyl)-2-(1-carboxy-ethylcarbamoyl)-propyl]-hydroxy-phosphinoyl}-ethyl-ammonium
TypeSmall organic molecule
Emp. Form.C15H23BrN2O5P
Mol. Mass.422.231
SMILESC[C@@H]([NH3+])P(O)(=O)C[C@@H](Cc1ccc(Br)cc1)C(=O)N[C@@H](C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: