Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM50001103
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30812
Ki>800000±n/a nM
Citation Hakimelahi, GHLy, TWMoosavi-Movahedi, AAJain, MLZakerinia, MDavari, HMei, HCSambaiah, TMoshfegh, AAHakimelahi, S Design, synthesis, and biological evaluation of novel nucleoside and nucleotide analogues as agents against DNA viruses and/or retroviruses. J Med Chem44:3710-20 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:ADA | Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40910.44
Organism:Bos taurus (bovine)
Description:n/a
Residue:363
Sequence:
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001103
NameBDBM50001103
Synonyms:(2-(6-amino-9H-purin-9-yl)ethoxy)methylphosphonic acid | (PMEA)[2-(6-Amino-purin-9-yl)-ethoxymethyl]-phosphonic acid | 9-(2-(phosphonomethoxy)ethyl)adenine | 9-[(2-phosphonylmethoxy)ethyl]adenine | 9-[2-(phosphonomethoxy)ethyl]adenine | 9-[2-phosphonomethoxyethyl]adenine | 9-[3-(Phosphonomethoxy)ethyl]adenine (PMEA) | ADEFOVIR | CHEMBL484 | GS-0393 | US10071110, Compound Adefovir | [2-(6-Amino-purin-9-yl)-ethoxymethyl]-phosphonic acid | [2-(6-Amino-purin-9-yl)-ethoxymethyl]-phosphonic acid(PMEA) | [2-(6-amino-9H-purin-9-yl)ethoxy]methylphosphonic acid | {[2-(6-AMINO-9H-PURIN-9-YL)ETHOXY]METHYL}PHOSPHONIC ACID
TypeSmall organic molecule
Emp. Form.C8H12N5O4P
Mol. Mass.273.1857
SMILESNc1ncnc2n(CCOCP(O)(O)=O)cnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a