Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50009263
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29318
Ki 130±n/a nM
Citation Rieger, JMBrown, MLSullivan, GWLinden, JMacdonald, TL Design, synthesis, and evaluation of novel A2A adenosine receptor agonists. J Med Chem44:531-9 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009263
NameBDBM50009263
Synonyms:(2S,3S,4R,5R)-5-(6-amino-2-(hex-1-ynyl)-9H-purin-9-yl)-N-ethyl-3,4-dihydroxy-tetrahydrofuran-2-carboxamide | 5-(6-Amino-2-hex-1-ynyl-purin-9-yl)-3,4-dihydroxy-tetrahydro-furan-2-carboxylic acid ethylamide | CHEMBL75416 | tert-butyl 1-[3-(1-amino-2-benzyloxycarbamoylethylcarboxamido)-2-hydroxy-4-phenylbutyl]tetrahydro-1H-2-pyrrolecarboxylate
TypeSmall organic molecule
Emp. Form.C31H42N4O7
Mol. Mass.582.6878
SMILESCC(C)(C)OC(=O)C1CCCN1CC(O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a