Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y1
LigandBDBM50118238
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147721
IC50 52±n/a nM
Citation Kim, HSRavi, RGMarquez, VEMaddileti, SWihlborg, AKErlinge, DMalmsjö, MBoyer, JLHarden, TKJacobson, KA Methanocarba modification of uracil and adenine nucleotides: high potency of Northern ring conformation at P2Y1, P2Y2, P2Y4, and P2Y11 but not P2Y6 receptors. J Med Chem45:208-18 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y1
Name:Purinergic receptor P2Y1
Synonyms:ATP receptor | P2Y purinoceptor 1 (P2Y1) | P2Y1 | Purinergic receptor
Type:Enzyme
Mol. Mass.:42090.25
Organism:Homo sapiens (Human)
Description:P47900
Residue:373
Sequence:
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118238
NameBDBM50118238
Synonyms:CHEMBL339873 | MRS 2279
TypeSmall organic molecule
Emp. Form.C13H18ClN5O8P2
Mol. Mass.469.711
SMILESCNc1nc(Cl)nc2n(cnc12)[C@H]1CC(OP(O)(O)=O)C2(COP(O)(O)=O)CC12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a