Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2Y purinoceptor 1
LigandBDBM50409486
Substrate/Competitorn/a
Meas. Tech.ChEMBL_162518
EC50 14±n/a nM
Citation Kim, HSRavi, RGMarquez, VEMaddileti, SWihlborg, AKErlinge, DMalmsjö, MBoyer, JLHarden, TKJacobson, KA Methanocarba modification of uracil and adenine nucleotides: high potency of Northern ring conformation at P2Y1, P2Y2, P2Y4, and P2Y11 but not P2Y6 receptors. J Med Chem45:208-18 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2Y purinoceptor 1
Name:P2Y purinoceptor 1
Synonyms:n/a
Type:n/a
Mol. Mass.:41199.64
Organism:Meleagris gallopavo
Description:n/a
Residue:362
Sequence:
MTEALISAALNGTQPELLAGGWAAGNASTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV
AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF
HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG
TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN
SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG
LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT
SL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50409486
NameBDBM50409486
Synonyms:CHEMBL2111533
TypeSmall organic molecule
Emp. Form.C12H18N5O12P3
Mol. Mass.517.2189
SMILESNc1ncnc2n(cnc12)[C@@H]1[C@H]2C[C@@]2(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a