Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoxygenase-1
LigandBDBM50114094
Substrate/Competitorn/a
Meas. Tech.ChEMBL_169
IC50 57±n/a nM
Citation Whitman, SGezginci, MTimmermann, BNHolman, TR Structure-activity relationship studies of nordihydroguaiaretic acid inhibitors toward soybean, 12-human, and 15-human lipoxygenase. J Med Chem45:2659-61 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lipoxygenase-1
Name:Seed lipoxygenase-1
Synonyms:15-LOX | 15-Lipo-oxygenase (15-LO) | 15-lipo-oxygenase (SLO) | Arachidonic Acid 15- Lipoxygenase | L-1 | Lipoxygenase (LOX) | Lipoxygenase (SLO) | Seed lipoxygenase-1
Type:Enzyme
Mol. Mass.:94365.66
Organism:Glycine max (soybean)
Description:n/a
Residue:839
Sequence:
MFSAGHKIKGTVVLMPKNELEVNPDGSAVDNLNAFLGRSVSLQLISATKADAHGKGKVGK
DTFLEGINTSLPTLGAGESAFNIHFEWDGSMGIPGAFYIKNYMQVEFFLKSLTLEAISNQ
GTIRFVCNSWVYNTKLYKSVRIFFANHTYVPSETPAPLVSYREEELKSLRGNGTGERKEY
DRIYDYDVYNDLGNPDKSEKLARPVLGGSSTFPYPRRGRTGRGPTVTDPNTEKQGEVFYV
PRDENLGHLKSKDALEIGTKSLSQIVQPAFESAFDLKSTPIEFHSFQDVHDLYEGGIKLP
RDVISTIIPLPVIKELYRTDGQHILKFPQPHVVQVSQSAWMTDEEFAREMIAGVNPCVIR
GLEEFPPKSNLDPAIYGDQSSKITADSLDLDGYTMDEALGSRRLFMLDYHDIFMPYVRQI
NQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVSQVVLPAKEGVESTIWL
LAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLHPIYKLLTPHYRNNMNINA
LARQSLINANGIIETTFLPSKYSVEMSSAVYKNWVFTDQALPADLIKRGVAIKDPSTPHG
VRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKNDSELQHWWKEAVEKGHGDL
KDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYGGLIMNRPTASRRLLPEKGT
PEYEEMINNHEKAYLRTITSKLPTLISLSVIEILSTHASDEVYLGQRDNPHWTSDSKALQ
AFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQLPYTLLYPSSEEGLTFRGIPNSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50114094
NameBDBM50114094
Synonyms:4-bromo-5-[(2R,3S)-4-(2-bromo-4,5-dihydroxyphenyl)-2,3-dimethylbutyl]benzene-1,2-diol | CHEMBL89283
TypeSmall organic molecule
Emp. Form.C18H20Br2O4
Mol. Mass.460.157
SMILESC[C@@H](Cc1cc(O)c(O)cc1Br)[C@H](C)Cc1cc(O)c(O)cc1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a