Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50121649
Substrate/Competitorn/a
Meas. Tech.ChEMBL_70854
IC50 3193±n/a nM
Citation Balboni, GSalvadori, SGuerrini, RNegri, LGiannini, EJinsmaa, YBryant, SDLazarus, LH Potent delta-opioid receptor agonists containing the Dmt-Tic pharmacophore. J Med Chem45:5556-63 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121649
NameBDBM50121649
Synonyms:2-[({2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carbonyl}-amino)-methyl]-benzoimidazole-1-carboxylic acid
TypeSmall organic molecule
Emp. Form.C30H31N5O5
Mol. Mass.541.5976
SMILESCc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2CC1C(=O)NCc1nc2ccccc2n1C(O)=O
Structure
n/a