Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase AmpC
LigandBDBM50065297
Substrate/Competitorn/a
Meas. Tech.ChEMBL_216014
IC50 6000±n/a nM
Citation McGovern, SLCaselli, EGrigorieff, NShoichet, BK A common mechanism underlying promiscuous inhibitors from virtual and high-throughput screening. J Med Chem45:1712-22 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase AmpC
Name:Beta-lactamase AmpC
Synonyms:Beta-lactamase | Beta-lactamase (AmpC) | Cephalosporinase | Escherichia coli K-12
Type:Protien
Mol. Mass.:41561.62
Organism:Escherichia coli
Description:P00811
Residue:377
Sequence:
MFKTTLCALLITASCSTFAAPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWG
YADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGI
TLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVK
PSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVK
STIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSII
NGSDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNY
PNPARVDAAWQILNALQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065297
NameBDBM50065297
Synonyms:3-(4-Isopropyl-benzylidene)-1,3-dihydro-indol-2-one | 3-[1-(4-Isopropyl-phenyl)-meth-(E)-ylidene]-1,3-dihydro-indol-2-one | CHEMBL48760
TypeSmall organic molecule
Emp. Form.C18H17NO
Mol. Mass.263.3337
SMILESCC(C)c1ccc(\C=C2\C(=O)Nc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a