Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50065297
Substrate/Competitorn/a
Meas. Tech.ChEMBL_53613
IC50 30000±n/a nM
Citation McGovern, SLCaselli, EGrigorieff, NShoichet, BK A common mechanism underlying promiscuous inhibitors from virtual and high-throughput screening. J Med Chem45:1712-22 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:1.5.1.3 | DHFR
Type:n/a
Mol. Mass.:21652.69
Organism:Gallus gallus (Chicken)
Description:n/a
Residue:189
Sequence:
VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065297
NameBDBM50065297
Synonyms:3-(4-Isopropyl-benzylidene)-1,3-dihydro-indol-2-one | 3-[1-(4-Isopropyl-phenyl)-meth-(E)-ylidene]-1,3-dihydro-indol-2-one | CHEMBL48760
TypeSmall organic molecule
Emp. Form.C18H17NO
Mol. Mass.263.3337
SMILESCC(C)c1ccc(\C=C2\C(=O)Nc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a