Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxycarboxylic acid receptor 2
LigandBDBM50220842
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144336
Ki 72±n/a nM
Citation van Herk, TBrussee, Jvan den Nieuwendijk, AMvan der Klein, PAIJzerman, APStannek, CBurmeister, ALorenzen, A Pyrazole derivatives as partial agonists for the nicotinic acid receptor. J Med Chem46:3945-51 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hydroxycarboxylic acid receptor 2
Name:Hydroxycarboxylic acid receptor 2
Synonyms:HM74 nicotinic acid GPCR
Type:PROTEIN
Mol. Mass.:41476.06
Organism:Rattus norvegicus
Description:ChEMBL_820675
Residue:360
Sequence:
MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSIC
YTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVIC
FLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50220842
NameBDBM50220842
Synonyms:3-butyl-1H-pyrazole-5-carboxylic acid | 5-butyl-1H-pyrazole-3-carboxylic acid | CHEMBL428730
TypeSmall organic molecule
Emp. Form.C8H12N2O2
Mol. Mass.168.1931
SMILESCCCCc1cc(n[nH]1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a