Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurotensin receptor
LigandBDBM50133192
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144310
IC50 4±n/a nM
Citation Kokko, KPHadden, MKOrwig, KSMazella, JDix, TA In vitro analysis of stable, receptor-selective neurotensin[8-13] analogues. J Med Chem46:4141-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neurotensin receptor
Name:Neurotensin receptor
Synonyms:Levocabastine-sensitive neurotensin receptor | NT-R-2 | NTR2 | NTR2 receptor | Neurotensin receptor 2 | Neurotensin receptor type 2
Type:PROTEIN
Mol. Mass.:45404.76
Organism:Homo sapiens (Human)
Description:ChEMBL_1281495
Residue:410
Sequence:
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKA
RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY
ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL
ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV
PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA
VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133192
NameBDBM50133192
Synonyms:CHEMBL439494 | Compound NT
TypeSmall organic molecule
Emp. Form.C69H108N20O18
Mol. Mass.1505.719
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a