Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50027076
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149204
IC50 36000±n/a nM
Citation Hruby, VJ Peptide science: exploring the use of chemical principles and interdisciplinary collaboration for understanding life processes. J Med Chem46:4215-31 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42793.26
Organism:HEK293
Description:Oxytocin OXTR HEK293::B2R9L7
Residue:389
Sequence:
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027076
NameBDBM50027076
Synonyms:CHEMBL2370768
TypeSmall organic molecule
Emp. Form.C49H76N12O12S2
Mol. Mass.1089.331
SMILES[H][C@]12CCCN1C(=O)[C@]1([H])CSSC(C)(C)[C@@H](N)C(=O)N[C@]([H])([C@@H](C)c3c(C)cc(OC)cc3C)C(=O)N[C@@]([H])([C@@H](C)CC)C(=O)N[C@]([H])(CCC(=O)NCCCC[C@@H](NC2=O)C(=O)NCC(N)=O)C(=O)N[C@H](CC(N)=O)C(=O)N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a