Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM50133357
Substrate/Competitorn/a
Meas. Tech.ChEMBL_38727
IC50 7400±n/a nM
Citation Kitada, SLeone, MSareth, SZhai, DReed, JCPellecchia, M Discovery, characterization, and structure-activity relationships studies of proapoptotic polyphenols targeting B-cell lymphocyte/leukemia-2 proteins. J Med Chem46:4259-64 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133357
NameBDBM50133357
Synonyms:2,3,8-Trihydroxy-9-oxo-9H-benzocycloheptene-6-carboxylic acid | CHEMBL339835
TypeSmall organic molecule
Emp. Form.C12H8O6
Mol. Mass.248.1883
SMILESOC(=O)c1cc(O)c(=O)c2cc(O)c(O)cc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a