Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50125929
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30421
Ki 69±n/a nM
Citation Baraldi, PGFruttarolo, FTabrizi, MAPreti, DRomagnoli, REl-Kashef, HMoorman, AVarani, KGessi, SMerighi, SBorea, PA Design, synthesis, and biological evaluation of C9- and C2-substituted pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as new A2A and A3 adenosine receptors antagonists. J Med Chem46:1229-41 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptor
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50125929
NameBDBM50125929
Synonyms:2-(furan-2-yl)-8-methyl-9-(propylthio)-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-amine | 2-Furan-2-yl-8-methyl-9-propylsulfanyl-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-ylamine | CHEMBL280888
TypeSmall organic molecule
Emp. Form.C14H15N7OS
Mol. Mass.329.38
SMILESCCCSc1n(C)nc2nc(N)n3nc(nc3c12)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a