Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50139783
Substrate/Competitorn/a
Meas. Tech.ChEMBL_35277
Ki 0.62±n/a nM
Citation Rosenström, USköld, CLindeberg, GBotros, MNyberg, FKarlén, AHallberg, A A selective AT2 receptor ligand with a gamma-turn-like mimetic replacing the amino acid residues 4-5 of angiotensin II. J Med Chem47:859-70 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50139783
NameBDBM50139783
Synonyms:Angiotensin II analogue | CHEMBL404996
TypeSmall organic molecule
Emp. Form.C47H65N13O12S2
Mol. Mass.1068.229
SMILESCCSC[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a