Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric oxide synthase, inducible
LigandBDBM50139794
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89494
IC50 21400±n/a nM
Citation Hallinan, EAHagen, TJBergmanis, AMoore, WMJerome, GMSpangler, DPStevens, AMShieh, HSManning, PTPitzele, BS 5-Fluorinated L-lysine analogues as selective induced nitric oxide synthase inhibitors. J Med Chem47:900-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric oxide synthase, inducible
Name:Nitric oxide synthase, inducible
Synonyms:HEP-NOS | Hepatocyte NOS | Inducible NO synthase | Inducible NOS | NOS type II | Nitric oxide synthase, inducible (iNOS) | iNOS
Type:Homodimer
Mol. Mass.:131141.95
Organism:Homo sapiens (Human)
Description:P35228
Residue:1153
Sequence:
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
VAVQPSSLEMSAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50139794
NameBDBM50139794
Synonyms:6-Acetimidoylamino-2-amino-5,5-difluoro-hexanoic acid; dihydrochloride | CHEMBL536253
TypeSmall organic molecule
Emp. Form.C8H15F2N3O2
Mol. Mass.223.2204
SMILESCC(=N)NCC(F)(F)CCC(N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a