Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50140971
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30306
Ki 16±n/a nM
Citation Baraldi, PGTabrizi, MAPreti, DBovero, ARomagnoli, RFruttarolo, FZaid, NAMoorman, ARVarani, KGessi, SMerighi, SBorea, PA Design, synthesis, and biological evaluation of new 8-heterocyclic xanthine derivatives as highly potent and selective human A2B adenosine receptor antagonists. J Med Chem47:1434-47 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptors; A2a & A2b
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140971
NameBDBM50140971
Synonyms:CHEMBL32802 | N-(3,4-Dichloro-phenyl)-2-[5-(2,6-dioxo-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purin-8-yl)-1-methyl-1H-pyrazol-3-yloxy]-acetamide
TypeSmall organic molecule
Emp. Form.C23H25Cl2N7O4
Mol. Mass.534.395
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)-c1cc(OCC(=O)Nc2ccc(Cl)c(Cl)c2)nn1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a