Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethylthioadenosine Phosphorylase (MTAP)
LigandBDBM50148132
Substrate/Competitorn/a
Meas. Tech.ChEMBL_236
Ki 0.628±n/a nM
Citation Evans, GBFurneaux, RHSchramm, VLSingh, VTyler, PC Targeting the polyamine pathway with transition-state analogue inhibitors of 5'-methylthioadenosine phosphorylase. J Med Chem47:3275-81 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Methylthioadenosine Phosphorylase (MTAP)
Name:Methylthioadenosine Phosphorylase (MTAP)
Synonyms:5'-Methylthioadenosine phosphorylase (MTAP) | MTA phosphorylase | MTAPase | S-methyl-5 -thioadenosine phosphorylase
Type:Enzyme
Mol. Mass.:31239.23
Organism:Homo sapiens (Human)
Description:n/a
Residue:283
Sequence:
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR
HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR
PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR
AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148132
NameBDBM50148132
Synonyms:2-(4-Amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-m-tolylsulfanylmethyl-pyrrolidine-3,4-diol; 2hydrochloride | CHEMBL542449
TypeSmall organic molecule
Emp. Form.C18H21N5O2S
Mol. Mass.371.457
SMILESCc1cccc(SCC2NC(C(O)C2O)c2c[nH]c3c(N)ncnc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a