Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase
LigandBDBM18351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304920
IC50 50±n/a nM
Citation Godin, GCompain, PMartin, ORIkeda, KYu, LAsano, N Alpha-1-C-alkyl-1-deoxynojirimycin derivatives as potent and selective inhibitors of intestinal isomaltase: remarkable effect of the alkyl chain length on glycosidase inhibitory profile. Bioorg Med Chem Lett14:5991-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase
Name:Alpha-glucosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:102549.55
Organism:Oryza sativa subsp. japonica
Description:ChEMBL_304920
Residue:929
Sequence:
MLASLSSSSRAAISCIPLCLLFLTLASSNGVFAAAPPKVGSGYKLVSLVEHPEGGALVGY
LQVKQRTSTYGPDIPLLRLYVKHETKDRIRVQITDADKPRWEVPYNLLQREPAPPVTGGR
ITGVPFAAGEYPGEELVFTYGRDPFWFAVHRKSSREALFNTSCGALVFKDQYIEASTSLP
RDAALYGLGENTQPGGIRLRPNDPYTIYTTDISAINLNTDLYGSHPVYVDLRSRGGHGVA
HAVLLLNSNGMDVFYRGTSLTYKVIGGLLDFYLFSGPTPLAVVDQYTSMIGRPAPMPYWA
FGFHQCRWGYKNLSVVEGVVEGYRNAQIPLDVIWNDDDHMDAAKDFTLDPVNYPRPKLLE
FLDKIHAQGMKYIVLIDPGIAVNNTYGVYQRGMQGDVFIKLDGKPYLAQVWPGPVYFPDF
LNPNGVSWWIDEVRRFHDLVPVDGLWIDMNEASNFCTGKCEIPTTHLCPLPNTTTPWVCC
LDCKNLTNTRWDEPPYKINASGQTARLGFNTIATSATHYNGILEYNAHSLYGFSQAIATH
QALQGLQGKRPFILTRSTFVGSGAYAAHWTGDNKGTWENLRYSISTMLNFGIFGMPMVGA
DICGFYPQPTEELCNRWIELGAFYPFSRDHANFASPRQELYVWESVAKSARNALGMRYRL
LPYLYTLNYQAHLTGAPVARPVFFSFPDFTPCYGLSTQYLLGASVMVSPVLEQGATSVSA
MFPPGSWYNLFDTTKVVVSRGEGAVKLDAPLNEINVHVFQNTILPMQRGGTISKEARATP
FTLVVAFPFGATEAEAEGAVYVDDDERPEMVLAEGQATYVRFYATVRGKAVTVRSEVELG
SYSLQKGLLIEKLSVLGLEGTGRDLAVHVDGANATAIATSRPYFAGAEAELHGHRDVEGH
KKSVMVEVGGLALPLGKSFTMTWNMQIEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18351
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a