Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50156176
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303706
Ki 1±n/a nM
Citation Johannesson, PErdélyi, MLindeberg, GFrändberg, PANyberg, FKarlén, AHallberg, A AT2-selective angiotensin II analogues containing tyrosine-functionalized 5,5-bicyclic thiazabicycloalkane dipeptide mimetics. J Med Chem47:6009-19 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156176
NameBDBM50156176
Synonyms:(2S,5R,7aR)-6-[2-((S)-Acetylamino)-3-methyl-butyrylamino]-6-benzyl-5-oxo-hexahydro-pyrrolo[2,1-b]thiazole-3-carboxylic acid [(S)-2-(1H-imidazol-4-yl)-1-methylcarbamoyl-ethyl]-amide | CHEMBL187880
TypeSmall organic molecule
Emp. Form.C28H37N7O6S
Mol. Mass.599.702
SMILESCNC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CS[C@H]2C[C@@](Cc3ccc(O)cc3)(NC(=O)[C@@H](NC(C)=O)C(C)C)C(=O)N12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a