Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50168428
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303241
Ki 0.8±n/a nM
Citation Rosenström, USköld, CPlouffe, BBeaudry, HLindeberg, GBotros, MNyberg, FWolf, GKarlén, AGallo-Payet, NHallberg, A New selective AT2 receptor ligands encompassing a gamma-turn mimetic replacing the amino acid residues 4-5 of angiotensin II act as agonists. J Med Chem48:4009-24 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50168428
NameBDBM50168428
Synonyms:(3S)-3-amino-3-{[(1S)-1-{[(1S)-1-{[(2S)-4-({[(2S)-1-[(2S)-2-{[(1S)-1-carboxy-2-phenylethyl]carbamoyl}pyrrolidin-1-yl]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]carbamoyl}methyl)-2-[(4-hydroxyphenyl)methyl]-3-oxo-2,3,4,5-tetrahydro-1H-1,4-benzodiazepin-9-yl]carbamoyl}-2-methylpropyl]carbamoyl}-4-[(diaminomethylidene)amino]butyl]carbamoyl}propanoic acid | CHEMBL265881
TypeSmall organic molecule
Emp. Form.C53H68N14O12
Mol. Mass.1093.1936
SMILESCC(C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CC(O)=O)C(=O)Nc1cccc2CN(CC(=O)N[C@@H](Cc3cnc[nH]3)C(=O)N3CCC[C@H]3C(=O)N[C@@H](Cc3ccccc3)C(O)=O)C(=O)[C@H](Cc3ccc(O)cc3)Nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a