Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2A5
LigandBDBM23989
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305268
IC50 9700±n/a nM
Citation Rahnasto, MRaunio, HPoso, AWittekindt, CJuvonen, RO Quantitative structure-activity relationship analysis of inhibitors of the nicotine metabolizing CYP2A6 enzyme. J Med Chem48:440-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2A5
Name:Cytochrome P450 2A5
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56752.73
Organism:Mus musculus
Description:ChEMBL_572014
Residue:494
Sequence:
MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNFLQLNTEQMYNSLMK
ISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVVFSS
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQ
RFADMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDK
GQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQAPQDIDVSPRLVGF
ATIPPTYTMSFLSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23989
NameBDBM23989
Synonyms:1,2,3,4-tetrahydronaphthalen-2-one | CHEMBL191664 | dihydro-naphthalenone, 4e | dihydronaphthalenone
TypeSmall organic molecule
Emp. Form.C10H10O
Mol. Mass.146.1858
SMILESO=C1CCc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a