Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase A (α-Gal A)
LigandBDBM50163441
Substrate/Competitorn/a
Meas. Tech.ChEBML_305031
IC50 390000±n/a nM
Citation Kato, AKato, NKano, EAdachi, IIkeda, KYu, LOkamoto, TBanba, YOuchi, HTakahata, HAsano, N Biological properties of D- and L-1-deoxyazasugars. J Med Chem48:2036-44 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase A (α-Gal A)
Name:Alpha-galactosidase A
Synonyms:Alpha-D-galactosidase A | Alpha-D-galactoside galactohydrolase | INN=Agalsidase | Melibiase
Type:Protein
Mol. Mass.:48760.21
Organism:Homo sapiens (Human)
Description:n/a
Residue:429
Sequence:
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163441
NameBDBM50163441
Synonyms:(2R,3S,4S,5R)-2-Hydroxymethyl-piperidine-3,4,5-triol | CHEMBL368121
TypeSmall organic molecule
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@@H](O)[C@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a