Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50175584
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321033
pH7.4±n/a
Ki 1.85±n/a nM
Commentsextracted
Citation Georgsson, JSköld, CPlouffe, BLindeberg, GBotros, MLarhed, MNyberg, FGallo-Payet, NGogoll, AKarlén, AHallberg, A Angiotensin II pseudopeptides containing 1,3,5-trisubstituted benzene scaffolds with high AT2 receptor affinity. J Med Chem48:6620-31 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50175584
NameBDBM50175584
Synonyms:(S)-3-Amino-N-((S)-1-{1-[(S)-3-[2-[2-((S)-(S)-1-carboxy-2-phenyl-ethylcarbamoyl)-pyrrolidin-1-yl]-1-(3H-imidazol-4-ylmethyl)-2-oxo-ethylcarbamoyl]-5-(4-hydroxy-benzyl)-benzylcarbamoyl]-2-methyl-propylcarbamoyl}-4-guanidino-butyl)-succinamic acid | CHEMBL428986
TypeSmall organic molecule
Emp. Form.C50H64N12O11
Mol. Mass.1009.117
SMILESCC(C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CC(O)=O)C(=O)NCc1cc(Cc2ccc(O)cc2)cc(c1)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a