Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50176718
Substrate/Competitorn/a
Meas. Tech.ChEMBL_327856
Ki 2±n/a nM
Citation Starck, JPTalaga, PQuéré, LCollart, PChristophe, BLo Brutto, PJadot, SChimmanamada, DZanda, MWagner, AMioskowski, CMassingham, RGuyaux, M Potent anti-muscarinic activity in a novel series of quinuclidine derivatives. Bioorg Med Chem Lett16:373-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176718
NameBDBM50176718
Synonyms:1-cyclohexyl-3-((R)-3-methoxyquinuclidin-3-yl)-1-phenylprop-2-yn-1-ol | CHEMBL200693
TypeSmall organic molecule
Emp. Form.C23H31NO2
Mol. Mass.353.4977
SMILESCO[C@@]1(CN2CCC1CC2)C#CC(O)(C1CCCCC1)c1ccccc1 |wU:2.1,wD:2.11,THB:1:2:5.6:9.8,(11.35,5.74,;12.84,5.36,;13.25,3.86,;13.44,2.49,;14.97,3.14,;16.34,2.52,;16.06,3.9,;14.71,4.51,;14.78,6.14,;15.23,5.04,;11.75,3.47,;10.26,3.07,;8.77,2.68,;8.38,4.16,;9.16,1.19,;8.06,.11,;8.45,-1.37,;9.93,-1.78,;11.03,-.69,;10.64,.8,;7.28,2.28,;6.19,3.37,;4.71,2.98,;4.3,1.49,;5.39,.39,;6.88,.8,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a