Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase, Soat
LigandBDBM50175770
Substrate/Competitorn/a
Meas. Tech.ChEMBL_328123
IC50>1000±n/a nM
Citation Ban, HMuraoka, MIoriya, KOhashi, N Synthesis and biological activity of novel 4-phenyl-1,8-naphthyridin-2(1H)-on-3-yl ureas: potent acyl-CoA:cholesterol acyltransferase inhibitor with improved aqueous solubility. Bioorg Med Chem Lett16:44-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase, Soat
Name:Sterol O-acyltransferase, Soat
Synonyms:ACAT-1 | Cholesterol acyltransferase 1
Type:PROTEIN
Mol. Mass.:64165.56
Organism:Rattus norvegicus
Description:ChEMBL_28796
Residue:545
Sequence:
MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLF
LKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISR
RSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVI
WTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLA
YTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPT
LIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLC
VFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVH
DWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMA
FNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWT
CRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50175770
NameBDBM50175770
Synonyms:1-(4-amino-2,6-diisopropylphenyl)-3-(1-butyl-4-(3-(2-hydroxyethoxy)phenyl)-2-oxo-1,2-dihydro-1,8-naphthyridin-3-yl)urea hydrochloride | CHEMBL538826
TypeSmall organic molecule
Emp. Form.C33H41N5O4
Mol. Mass.571.7097
SMILESCCCCn1c2ncccc2c(-c2cccc(OCCO)c2)c(NC(=O)Nc2c(cc(N)cc2C(C)C)C(C)C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a