Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor (V2)
LigandBDBM50177592
Substrate/Competitorn/a
Meas. Tech.ChEMBL_334037
EC50 1.67±n/a nM
Citation Failli, AAShumsky, JSSteffan, RJCaggiano, TJWilliams, DKTrybulski, EJNing, XLock, YTanikella, THartmann, DChan, PSPark, CH Pyridobenzodiazepines: a novel class of orally active, vasopressin V2 receptor selective agonists. Bioorg Med Chem Lett16:954-9 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor (V2)
Name:Vasopressin receptor
Synonyms:AVPR V2 | AVPR2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2 | Vasopressin V2 receptor
Type:Receptor
Mol. Mass.:40295.28
Organism:Homo sapiens (Human)
Description:P30518
Residue:371
Sequence:
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177592
NameBDBM50177592
Synonyms:(5,11-dihydro-benzo[b]pyrido[2,3-e][1,4]diazepin-6-yl)-[4-(3-methyl-pyrazol-1-yl)-2-trifluoromethyl-phenyl]-methanone | CHEMBL201889
TypeSmall organic molecule
Emp. Form.C24H18F3N5O
Mol. Mass.449.4278
SMILESCc1ccn(n1)-c1ccc(C(=O)N2Cc3cccnc3Nc3ccccc23)c(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a