Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKetopantoate reductase
LigandBDBM18137
Substrate/Competitorn/a
Meas. Tech.ChEMBL_382751
Kd>5000000±n/a nM
Citation Ciulli, AWilliams, GSmith, AGBlundell, TLAbell, C Probing hot spots at protein-ligand binding sites: a fragment-based approach using biophysical methods. J Med Chem49:4992-5000 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ketopantoate reductase
Name:Ketopantoate reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33866.35
Organism:Escherichia coli (strain K12)
Description:ChEMBL_382751
Residue:303
Sequence:
MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETDGSIFNESLTANDPDF
LATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNIQQPLLMGTTTH
AARRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDVAWHNNIRAELWRKLAVN
CVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTSAEDLRDYVMQVIDATAE
NISSMLQDIRALRHTEIDYINGFLLRRARAHGIAVPENTRLFEMVKRKESEYERIGTGLP
RPW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18137
NameBDBM18137
Synonyms:AMP | CHEMBL752 | [(2R,3S,4R,5R)-5-adenin-9-yl-3,4-dihydroxy-tetrahydrofuran-2-yl]methyl dihydrogen phosphate;hydrate | adenosine 5 -monophosphate | {[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid
TypeNucleoside or nucleotide
Emp. Form.C10H14N5O7P
Mol. Mass.347.2212
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a