Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50370375
Substrate/Competitorn/a
Meas. Tech.ChEMBL_414989
Ki 0.7±n/a nM
Citation Rosenström, USköld, CLindeberg, GBotros, MNyberg, FKarlén, AHallberg, A Design, synthesis, and incorporation of a beta-turn mimetic in angiotensin II forming novel pseudopeptides with affinity for AT1 and AT2 receptors. J Med Chem49:6133-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370375
NameBDBM50370375
Synonyms:CHEMBL268815
TypeSmall organic molecule
Emp. Form.C53H74N12O12
Mol. Mass.1071.2279
SMILES[#6]-[#6]-[#6@@H](-[#6])-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccc(-[#8])cc1)-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#7]-[#6](=O)-[#6@@H](-[#7])-[#6]-[#6](-[#8])=O)-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccc(-[#7])cc1)-[#6](=O)-[#7]-1-[#6]-[#6]-[#6]-[#6@H]-1-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](-[#8])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a