Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 Receptor
LigandBDBM50205305
Substrate/Competitorn/a
Meas. Tech.ChEMBL_425925
Ki 0.2±n/a nM
Citation Pena, AMurat, BTrueba, MVentura, MAWo, NCSzeto, HHCheng, LLStoev, SGuillon, GManning, M Design and synthesis of the first selective agonists for the rat vasopressin V(1b) receptor: based on modifications of deamino-[Cys1]arginine vasopressin at positions 4 and 8. J Med Chem50:835-47 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 Receptor
Name:Vasopressin receptor
Synonyms:AVPR V2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2
Type:G-protein coupled receptor
Mol. Mass.:40761.85
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:371
Sequence:
MLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG
ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ
RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP
SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA
PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT
ASSSLMKDTPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205305
NameBDBM50205305
Synonyms:CHEMBL375324 | d[Arg4]AVP
TypeSmall organic molecule
Emp. Form.C47H68N16O11S2
Mol. Mass.1097.273
SMILES[#7]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1-[#6](=O)-[#6@@H]-1-[#6]-[#16]-[#16]-[#6]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-c2ccc(-[#8])cc2)-[#6](=O)-[#7]-[#6@@H](-[#6]-c2ccccc2)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#7]-[#6](-[#7])=[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a