Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin receptor
LigandBDBM50205309
Substrate/Competitorn/a
Meas. Tech.ChEMBL_425924
Ki 0.16±n/a nM
Citation Pena, AMurat, BTrueba, MVentura, MAWo, NCSzeto, HHCheng, LLStoev, SGuillon, GManning, M Design and synthesis of the first selective agonists for the rat vasopressin V(1b) receptor: based on modifications of deamino-[Cys1]arginine vasopressin at positions 4 and 8. J Med Chem50:835-47 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin receptor
Name:Vasopressin receptor
Synonyms:AVPR1B | VASOPRESSIN V1B | Vasopressin V1b receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:47104.48
Organism:RAT
Description:VASOPRESSIN V1B AVPR1B RAT::P48974
Residue:425
Sequence:
MNSEPSWTATPSPGGTLPVPNATTPWLGRDEELAKVEIGILATVLVLATGGNLAVLLTLG
RHGHKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLRQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQG
SGVLDCWADFYFSWGPRAYITWTTMAIFVLPVAVLSACYGLICHEIYKNLKVKTQAGREE
RRGWRTWDKSSSSAVATAATRGLPSRVSSISTISRAKIRTVKMTFVIVLAYIACWAPFFS
VQMWSVWDENAPNEDSTNVAFTISMLLGNLSSCCNPWIYMGFNSRLLPRSLSHHACCTGS
KPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATM
ETSIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205309
NameBDBM50205309
Synonyms:CHEMBL412972 | d[Leu4,Lys8]VP
TypeSmall organic molecule
Emp. Form.C47H67N11O11S2
Mol. Mass.1026.232
SMILESCC(C)C[C@@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)CCSSC[C@H](NC(=O)[C@H](CC(N)=O)NC1=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)NCC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a