Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50213574
Substrate/Competitorn/a
Meas. Tech.ChEMBL_436894
Ki 7960±n/a nM
Citation Chlon-Rzepa, GZmudzki, PZajdel, PBojarski, AJDuszynska, BNikiforuk, ATatarczynska, EPawlowski, M 7-Arylpiperazinylalkyl and 7-tetrahydroisoquinolinylalkyl derivatives of 8-alkoxy-purine-2,6-dione and some of their purine-2,6,8-trione analogs as 5-HT(1A), 5-HT(2A), and 5-HT(7) serotonin receptor ligands. Bioorg Med Chem15:5239-50 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:5-HT-2 | 5-HT-2A | 5-HT-S1A | 5-HT-S2 | 5-HT2 | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2A | Serotonin Receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52852.05
Organism:Rattus norvegicus (rat)
Description:Rat cortex membranes 5-HT2A receptors.
Residue:471
Sequence:
MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK
SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50213574
NameBDBM50213574
Synonyms:7-{3-[1,2,3,4-tetrahydroisoquinolin-2-yl]-propyl}-1,3-dimethyl-7,9-dihydro-3H-purine-2,6,8-trione | CHEMBL389842
TypeSmall organic molecule
Emp. Form.C19H23N5O3
Mol. Mass.369.4176
SMILESCn1c2[nH]c(=O)n(CCCN3CCc4ccccc4C3)c2c(=O)n(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a