Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50224351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_450740
IC50 11.61±n/a nM
Citation Da Settimo, FPrimofiore, GTaliani, SMarini, AMLa Motta, CSimorini, FSalerno, SSergianni, VTuccinardi, TMartinelli, ACosimelli, BGreco, GNovellino, ECiampi, OTrincavelli, MLMartini, C 5-amino-2-phenyl[1,2,3]triazolo[1,2-a][1,2,4]benzotriazin-1-one: a versatile scaffold to obtain potent and selective A3 adenosine receptor antagonists. J Med Chem50:5676-84 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224351
NameBDBM50224351
Synonyms:CHEMBL235717 | N-(8-chloro-1-oxo-2-p-tolyl-1H-3,3a,5,9b-tetraaza-cyclopenta[a]naphthalen-4-yl)-4-methoxy-benzamide
TypeSmall organic molecule
Emp. Form.C24H18ClN5O3
Mol. Mass.459.884
SMILESCOc1ccc(cc1)C(=O)Nc1nc2ccc(Cl)cc2n2n1nc(-c1ccc(C)cc1)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a