Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B
LigandBDBM50371947
Substrate/Competitorn/a
Meas. Tech.ChEMBL_464363
IC50 140000±n/a nM
Citation Hoang, VLLi, YKim, SK Cathepsin B inhibitory activities of phthalates isolated from a marine Pseudomonas strain. Bioorg Med Chem Lett18:2083-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin B
Name:Cathepsin B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:37275.39
Organism:Mus musculus
Description:ChEMBL_464363
Residue:339
Sequence:
MWWSLILLSCLLALTSAHDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCG
TVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDR
TCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCL
PYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIM
AEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSW
NLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371947
NameBDBM50371947
Synonyms:BIS(2-ETHYLHEXYL)PHTHALATE
TypeSmall organic molecule
Emp. Form.C24H38O4
Mol. Mass.390.5561
SMILESCCCC[C@H](CC)COC(=O)c1ccccc1C(=O)OC[C@H](CC)CCCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a